PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV20156.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family SRS
Protein Properties Length: 331aa    MW: 36339.4 Da    PI: 8.3545
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV20156.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702212.69.2e-661142744153
      DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..aeaaskrkrel........kskkqsalss.tkl 91 
                  +++CqdCGnqakkdCah RCRtCCksrgf+C+th+kstWvpaakrrerqqqlaa++++++  +  a +++kr re+        ++    al++ t  
  KZV20156.1 114 AGMNCQDCGNQAKKDCAHLRCRTCCKSRGFSCQTHLKSTWVPAAKRRERQQQLAALQQDRQLLTvrAGENPKRLRENpaggdgggSCGGGPALARaTDS 212
                 679****************************************************99888765555777788888888888887744444444330333 PP

      DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                     s++ +++ +lP+ev+s+avfrcvrvs++dd+ee++aYqt+v+igGhvfkGiLydqG e
  KZV20156.1 213 RFLASTSGFDFGHLPPEVNSPAVFRCVRVSAMDDAEEHFAYQTSVNIGGHVFKGILYDQGRE 274
                 3445667788888***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.2E-64115274IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.0E-26117159IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.1E-25225272IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MSGFFSLGGK DQGLQQKDSS NTSFFLFKNE EIYTKGYELW QQYHHLHQQR LQHQQQNLLH  60
CFQDVDFSDG PSGSNIRRNS NIVISSDIGD DSSTYSYRSA SGFRVTRPGK GANAGMNCQD  120
CGNQAKKDCA HLRCRTCCKS RGFSCQTHLK STWVPAAKRR ERQQQLAALQ QDRQLLTVRA  180
GENPKRLREN PAGGDGGGSC GGGPALARAT DSRFLASTSG FDFGHLPPEV NSPAVFRCVR  240
VSAMDDAEEH FAYQTSVNIG GHVFKGILYD QGREIRYPCG GGDQGSSAQQ PLDLITAATS  300
HPNVPMLDPS IYPTPMSSFM AGTQFFSPPR P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083639.11e-143PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ52e-76SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0D2QC221e-102A0A0D2QC22_G
TrEMBLA0A022RAI11e-101A0A022RAI1_ERYGU; Uncharacterized protein
STRINGVIT_18s0001g13420.t017e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-61SHI-related sequence 5